PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010544846.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family ARF
Protein Properties Length: 633aa    MW: 70286.6 Da    PI: 6.4165
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010544846.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3696.6e-22130230198
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++ +k+a+e+       +   +  ++l+ +d+ g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +
  XP_010544846.1 130 FVKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPAQELVARDLLGFEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGE 220
                     89****************************9544..444559************************************************..348 PP

                     EE..EEEEE- CS
              B3  89 efelvvkvfr 98 
                     ++ l+v+v+r
  XP_010544846.1 221 NGDLRVGVRR 230
                     8889***998 PP

2Auxin_resp97.61.8e-32256335183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+stk+ F v+Y+Pr   s+F+v v+k+++a+k+ +svGm f+m+fe+e+s+er ++Gt+vg+ dl+p +Wp+SkWrsL+
  XP_010544846.1 256 ASHAVSTKTLFVVFYKPRI--SQFIVGVNKYMEAVKHCFSVGMWFRMRFEGEESPERIFTGTIVGIGDLSP-QWPDSKWRSLQ 335
                     789***************8..9*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.19E-39119259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-38122245IPR015300DNA-binding pseudobarrel domain
CDDcd100174.85E-19128230No hitNo description
SMARTSM010192.0E-19130232IPR003340B3 DNA binding domain
PROSITE profilePS5086311.744130232IPR003340B3 DNA binding domain
PfamPF023625.5E-20130230IPR003340B3 DNA binding domain
PfamPF065075.4E-30256335IPR010525Auxin response factor
PfamPF023093.2E-8505554IPR033389AUX/IAA domain
SuperFamilySSF542772.16E-12511594No hitNo description
PROSITE profilePS5174526.22518610IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MANADGDFMG SSISDGRSGF DHDDLYTELW KACAGPLVEV PGVGERVFYF PQGHMEQLVA  60
STNQGLDEHI PLFNLPAKIL CRVLGVTLKA EHETDEVYAQ ITLKPENDQS ELTSSDPPLP  120
QPPKQAVHSF VKILTASDTS THGGFSVLRK HATECLPALD MTQATPAQEL VARDLLGFEW  180
RFKHIFRGQP RRHLLTTGWS TFVTSKRLVA GDAFVFLRGE NGDLRVGVRR LARQQSTMPS  240
SVISSQSMHL GVLATASHAV STKTLFVVFY KPRISQFIVG VNKYMEAVKH CFSVGMWFRM  300
RFEGEESPER IFTGTIVGIG DLSPQWPDSK WRSLQIQWDE PASVQRPDRV SPWEIEPFLP  360
SPSVARHSQP QPQLKCKRSR PIDSPISDMA ASSAASNFMY GFHHGHEPNA SLTLFQESSS  420
AGGYSPSVLF KPTNNSITSE QKPETPTSCF RLFGFDLTSK PSAPTPTDKE PISMPLDSTS  480
GSAKCQDPSL VKEQKKQDAP VSSSLQGRQQ ESANTSTRSR TKVQMQGMAV GRAVDLTVLR  540
SYEELIEELE KMFEMEGQLR SRDKWAVVFT DDEGDIMLAG DDPWIEFCKM AKKIFIYSSE  600
EVKKMSTKSK VSSLSMEGEG TIVSLDSDQR LLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-167103583355Auxin response factor 1
4ldw_A1e-167103583355Auxin response factor 1
4ldw_B1e-167103583355Auxin response factor 1
4ldx_A1e-167103583355Auxin response factor 1
4ldx_B1e-167103583355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544846.10.0PREDICTED: auxin response factor 18
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLR0FT390.0R0FT39_9BRAS; Auxin response factor
STRINGAT3G61830.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18